General Information

  • ID:  hor005725
  • Uniprot ID:  Q9PW68
  • Protein name:  Neuropeptide Y
  • Gene name:  npy
  • Organism:  Typhlonectes natans (Rubber eel)
  • Family:  NPY family
  • Source:  animal
  • Expression:  Expressed throughout the brain with highest levels of expression in medial pallium, basal forebrain, preoptic area, midbrain tegmentum and trigeminal nucleus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Typhlonectes (genus), Typhlonectidae (family), Gymnophiona (order), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY
  • Length:  36
  • Propeptide:  MQGSMRLWLSVLTFTLSLLICLGTLADAYPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRYGKRSNPETMVSDVWWRESTENIPRSRFEDPSMW
  • Signal peptide:  MQGSMRLWLSVLTFTLSLLICLGTLADA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone
  • Mechanism:  T36 Tyrosine amide
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9PW68-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005725_AF2.pdbhor005725_ESM.pdb

Physical Information

Mass: 486917 Formula: C189H284N52O58S
Absent amino acids: CFVW Common amino acids: Y
pI: 7.51 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -117.78 Boman Index: -9898
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 54.44
Instability Index: 6583.33 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  11287086
  • Title:  Characterization and distribution of neuropeptide Y in the brain of a caecilian amphibian.